PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_30684
Common NameKK1_033323
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family BBR-BPC
Protein Properties Length: 262aa    MW: 29638.7 Da    PI: 9.8486
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_30684genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind41.16.4e-131108190
      GAGA_bind   1 mdddgsre..rnkg.yye..............pa.aslkenlglqlmssiaerdaki..rernlalsekkaavaerdmaflqrdkalaernkalve 76 
                    mdd  ++e  r+k  yy+              ++ ++l   +++++ s++aer+a+i   e ++a+sek++a+a+rd a  qrd+a+a+r++al+e
  C.cajan_30684   1 MDDGRQHEnsRHKMdYYRgahslwntdsqhqvKEpNALV--MNKKIRSIMAERQAAIleLELEAAISEKNEALAARDAAIRQRDEAIAQRDHALLE 94 
                    666655555799988999999999999877663335666..99**************77677889******************************* PP

      GAGA_bind  77 rdnkllalllvens 90 
                    rdn+l+al++v+  
  C.cajan_30684  95 RDNALAALQTVKSH 108
                    *********98765 PP

2GAGA_bind263.31.3e-80107262144301
      GAGA_bind 144 akekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCttti 239
                    ++++kk+k ++  +++ +k+  k+kk +e+ +++ ++e+  ++ ++e++ +d++ln v++De+ +PvPvC+CtG++rqCYkWGnGGWqS+CCttt+
  C.cajan_30684 107 SHQTKKTKDNKVINSKASKTPCKVKKMGEDLNRQASSEG--TKIRSEWDRQDVGLNLVAFDETIMPVPVCTCTGVPRQCYKWGNGGWQSSCCTTTL 200
                    445555565666666666666699999999988888888..67***************************************************** PP

      GAGA_bind 240 SvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                    S+yPLP+ +++r+aRi+grKmS+++f++lL++La+eG+dls p+DLk++WA+HGtn+++ti+
  C.cajan_30684 201 SMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLASEGHDLSIPLDLKEYWARHGTNRYITIK 262
                    *************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.5E-1231262IPR010409GAGA-binding transcriptional activator
PfamPF062174.5E-91114IPR010409GAGA-binding transcriptional activator
PfamPF062171.3E-80102262IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MDDGRQHENS RHKMDYYRGA HSLWNTDSQH QVKEPNALVM NKKIRSIMAE RQAAILELEL  60
EAAISEKNEA LAARDAAIRQ RDEAIAQRDH ALLERDNALA ALQTVKSHQT KKTKDNKVIN  120
SKASKTPCKV KKMGEDLNRQ ASSEGTKIRS EWDRQDVGLN LVAFDETIMP VPVCTCTGVP  180
RQCYKWGNGG WQSSCCTTTL SMYPLPQLPN KRHARIGGRK MSGSVFTRLL SRLASEGHDL  240
SIPLDLKEYW ARHGTNRYIT IK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-156AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525429.11e-173PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_006580620.11e-173PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_003525427.11e-173PREDICTED: protein BASIC PENTACYSTEINE4-like
SwissprotQ8S8C61e-119BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A151RRJ60.0A0A151RRJ6_CAJCA; Uncharacterized protein
STRINGGLYMA05G38430.21e-172(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-116basic pentacysteine 4